PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08635g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 266aa    MW: 29965 Da    PI: 7.8338
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08635g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.14.9e-18182216135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf08635g02001.1 182 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 216
                               *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.5E-812265IPR016679Transcription factor, GATA, plant
SMARTSM004012.0E-15176226IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.477176212IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-15177240No hitNo description
Gene3DG3DSA:3.30.50.106.5E-14178213IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.87E-12181228No hitNo description
PROSITE patternPS003440182207IPR000679Zinc finger, GATA-type
PfamPF003207.2E-16182216IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDVYGAEVFR IDDLLDLSND DIFSSSTGSS SNKTTNFDLN HHYHPPHSDN INLAAATYYD  60
PLIPNCADFT DKLCVPSDDV AELEWLSNFV EDSSNNYPSN SLIGTINLNS NNTSFHSKSR  120
SKRSRATTAN TSWASSLQQA HHKPADEEPN RNPQHSNNHN TMKPKKESRG RSCEMSDIPR  180
KCTHCASEKT PQWRTGPLGP KTLCNACGVR YKSGRLVPEY RPAASPTFVL TQHSNSHRKV  240
MELRRQKEVQ QQSQQQGMYG HHFQVC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591827.11e-173PREDICTED: GATA transcription factor 4-like
RefseqXP_016439221.11e-173PREDICTED: GATA transcription factor 4-like
SwissprotO497415e-69GATA2_ARATH; GATA transcription factor 2
TrEMBLM1AUN51e-112M1AUN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000307081e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.13e-60GATA transcription factor 2